Lineage for d1kuj.1 (1kuj B:,A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 302778Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 302796Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 302797Family b.77.3.1: Mannose-binding lectins [51102] (4 proteins)
  6. 302821Protein Jacalin [51103] (1 species)
  7. 302822Species Jackfruit (Artocarpus integrifolia) [51104] (4 PDB entries)
  8. 302831Domain d1kuj.1: 1kuj B:,A: [73010]

Details for d1kuj.1

PDB Entry: 1kuj (more details), 2 Å

PDB Description: crystal structure of jacalin complexed with 1-o-methyl-alpha-d-mannose

SCOP Domain Sequences for d1kuj.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1kuj.1 b.77.3.1 (B:,A:) Jacalin {Jackfruit (Artocarpus integrifolia)}
eqsgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgq
nhksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgt
pfnlpienglivgfkgsigywldyfsmylsl

SCOP Domain Coordinates for d1kuj.1:

Click to download the PDB-style file with coordinates for d1kuj.1.
(The format of our PDB-style files is described here.)

Timeline for d1kuj.1: