Lineage for d1kuj.4 (1kuj H:,G:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234156Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 234174Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 234175Family b.77.3.1: Mannose-binding lectins [51102] (4 proteins)
  6. 234199Protein Jacalin [51103] (1 species)
  7. 234200Species Jackfruit (Artocarpus integrifolia) [51104] (4 PDB entries)
  8. 234212Domain d1kuj.4: 1kuj H:,G: [73013]
    complexed with mam

Details for d1kuj.4

PDB Entry: 1kuj (more details), 2 Å

PDB Description: crystal structure of jacalin complexed with 1-o-methyl-alpha-d-mannose

SCOP Domain Sequences for d1kuj.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g1kuj.4 b.77.3.1 (H:,G:) Jacalin {Jackfruit (Artocarpus integrifolia)}
sgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

SCOP Domain Coordinates for d1kuj.4:

Click to download the PDB-style file with coordinates for d1kuj.4.
(The format of our PDB-style files is described here.)

Timeline for d1kuj.4: