Lineage for d1kf6m1 (1kf6 M:443-576)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696597Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2696598Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2696605Protein Fumarate reductase [46981] (2 species)
  7. 2696606Species Escherichia coli [TaxId:562] [46982] (5 PDB entries)
  8. 2696608Domain d1kf6m1: 1kf6 M:443-576 [72401]
    Other proteins in same PDB: d1kf6a2, d1kf6a3, d1kf6b1, d1kf6b2, d1kf6c_, d1kf6d_, d1kf6m2, d1kf6m3, d1kf6n1, d1kf6n2, d1kf6o_, d1kf6p_
    complexed with 1pe, act, ce1, f3s, fad, fes, hqo, k, oaa, sf4

Details for d1kf6m1

PDB Entry: 1kf6 (more details), 2.7 Å

PDB Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO
PDB Compounds: (M:) fumarate reductase flavoprotein

SCOPe Domain Sequences for d1kf6m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf6m1 a.7.3.1 (M:443-576) Fumarate reductase {Escherichia coli [TaxId: 562]}
dggenwakirdemglameegcgiyrtpelmqktidklaelqerfkrvritdtssvfntdl
lytielghglnvaecmahsamarkesrgahqrldegcterddvnflkhtlafrdadgttr
leysdvkittlppa

SCOPe Domain Coordinates for d1kf6m1:

Click to download the PDB-style file with coordinates for d1kf6m1.
(The format of our PDB-style files is described here.)

Timeline for d1kf6m1: