PDB entry 1kf6

View 1kf6 on RCSB PDB site
Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO
Class: oxidoreductase
Keywords: respiration, fumarate reductace, succinate dehydrogenase, complex II, quinol, quinone, OXIDOREDUCTASE
Deposited on 2001-11-19, released 2002-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.231
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fumarate reductase flavoprotein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kf6a1, d1kf6a2, d1kf6a3
  • Chain 'B':
    Compound: fumarate reductase iron-sulfur protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kf6b1, d1kf6b2
  • Chain 'C':
    Compound: fumarate reductase 15 kda hydrophobic protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kf6c_
  • Chain 'D':
    Compound: fumarate reductase 13 kda hydrophobic protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kf6d_
  • Chain 'M':
    Compound: fumarate reductase flavoprotein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kf6m1, d1kf6m2, d1kf6m3
  • Chain 'N':
    Compound: fumarate reductase iron-sulfur protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kf6n1, d1kf6n2
  • Chain 'O':
    Compound: fumarate reductase 15 kda hydrophobic protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kf6o_
  • Chain 'P':
    Compound: fumarate reductase 13 kda hydrophobic protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kf6p_
  • Heterogens: K, OAA, ACT, FES, F3S, SF4, FAD, HQO, CE1, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kf6A (A:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppakrvyggeadaadkaeaankkeka
    ng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kf6A (A:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kf6B (B:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kf6C (C:)
    ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
    dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
    ivilfvalyw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kf6D (D:)
    minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
    sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1kf6M (M:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppakrvyggeadaadkaeaankkeka
    ng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kf6M (M:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppa
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kf6N (N:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kf6O (O:)
    ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
    dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
    ivilfvalyw
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kf6P (P:)
    minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
    sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti