Lineage for d1kf6n2 (1kf6 N:1-105)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934046Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species)
  7. 2934050Species Escherichia coli [TaxId:562] [54326] (6 PDB entries)
  8. 2934052Domain d1kf6n2: 1kf6 N:1-105 [72405]
    Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6a3, d1kf6b1, d1kf6c_, d1kf6d_, d1kf6m1, d1kf6m2, d1kf6m3, d1kf6n1, d1kf6o_, d1kf6p_
    complexed with 1pe, act, ce1, f3s, fad, fes, hqo, k, oaa, sf4

Details for d1kf6n2

PDB Entry: 1kf6 (more details), 2.7 Å

PDB Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO
PDB Compounds: (N:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d1kf6n2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf6n2 d.15.4.2 (N:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd

SCOPe Domain Coordinates for d1kf6n2:

Click to download the PDB-style file with coordinates for d1kf6n2.
(The format of our PDB-style files is described here.)

Timeline for d1kf6n2: