SCOPe 2.08: Domain d1kf6b1: 1kf6 B:106-243

Lineage for d1kf6b1 (1kf6 B:106-243)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Fumarate reductase [46550] (3 species)

7. Species Escherichia coli [TaxId:562] [46551] (6 PDB entries)

8. Domain d1kf6b1: 1kf6 B:106-243 [72397]
   Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6a3, d1kf6b2, d1kf6c_, d1kf6d_, d1kf6m1, d1kf6m2, d1kf6m3, d1kf6n2, d1kf6o_, d1kf6p_
   complexed with 1pe, act, ce1, f3s, fad, fes, hqo, k, oaa, sf4

Details for d1kf6b1

PDB Entry: 1kf6, 2.7 Å

PDB Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO

PDB Compounds: (B:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d1kf6b1:

Sequence; same for both SEQRES and ATOM records:

>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

Timeline for d1kf6b1:

• d1kf6b1 first appeared in SCOP 1.61
  
• d1kf6b1 appears in SCOPe 2.07