Lineage for d1jssb_ (1jss B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2214994Family d.129.3.2: STAR domain [55966] (5 proteins)
    automatically mapped to Pfam PF01852
  6. 2214995Protein Cholesterol-regulated Start protein 4 (Stard4). [75545] (1 species)
  7. 2214996Species Mouse (Mus musculus) [TaxId:10090] [75546] (1 PDB entry)
  8. 2214998Domain d1jssb_: 1jss B: [71845]

Details for d1jssb_

PDB Entry: 1jss (more details), 2.2 Å

PDB Description: crystal structure of the mus musculus cholesterol-regulated start protein 4 (stard4).
PDB Compounds: (B:) cholesterol-regulated START protein 4

SCOPe Domain Sequences for d1jssb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jssb_ d.129.3.2 (B:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]}
asistklqntliqyhsieedewrvakkakdvtvwrkpseefngylykaqgvmddvvnnvi
dhirpgpwrldwdrlmtsldvlehfeenccvmryttagqllniisprefvdfsytvgyee
gllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtdlrgmipqsavd
tamastlanfysdlrkglr

SCOPe Domain Coordinates for d1jssb_:

Click to download the PDB-style file with coordinates for d1jssb_.
(The format of our PDB-style files is described here.)

Timeline for d1jssb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jssa_