SCOPe 2.08: Domain d1jssb_: 1jss B:

Lineage for d1jssb_ (1jss B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.2: STAR domain [55966] (5 proteins)
   automatically mapped to Pfam PF01852

6. Protein Cholesterol-regulated Start protein 4 (Stard4). [75545] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [75546] (1 PDB entry)

8. Domain d1jssb_: 1jss B: [71845]

Details for d1jssb_

PDB Entry: 1jss, 2.2 Å

PDB Description: crystal structure of the mus musculus cholesterol-regulated start protein 4 (stard4).

PDB Compounds: (B:) cholesterol-regulated START protein 4

SCOPe Domain Sequences for d1jssb_:

Sequence; same for both SEQRES and ATOM records:

>d1jssb_ d.129.3.2 (B:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]}
asistklqntliqyhsieedewrvakkakdvtvwrkpseefngylykaqgvmddvvnnvi
dhirpgpwrldwdrlmtsldvlehfeenccvmryttagqllniisprefvdfsytvgyee
gllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtdlrgmipqsavd
tamastlanfysdlrkglr

Timeline for d1jssb_:

• d1jssb_ first appeared in SCOP 1.61
  
• d1jssb_ appears in SCOPe 2.07