Lineage for d1jssb_ (1jss B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196532Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 196660Superfamily d.129.3: Bet v1-like [55961] (4 families) (S)
  5. 196680Family d.129.3.2: STAR domain [55966] (3 proteins)
  6. 196681Protein Cholesterol-regulated Start protein 4 (Stard4). [75545] (1 species)
  7. 196682Species Mouse (Mus musculus) [TaxId:10090] [75546] (1 PDB entry)
  8. 196684Domain d1jssb_: 1jss B: [71845]

Details for d1jssb_

PDB Entry: 1jss (more details), 2.2 Å

PDB Description: crystal structure of the mus musculus cholesterol-regulated start protein 4 (stard4).

SCOP Domain Sequences for d1jssb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jssb_ d.129.3.2 (B:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus)}
asistklqntliqyhsieedewrvakkakdvtvwrkpseefngylykaqgvmddvvnnvi
dhirpgpwrldwdrlmtsldvlehfeenccvmryttagqllniisprefvdfsytvgyee
gllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtdlrgmipqsavd
tamastlanfysdlrkglr

SCOP Domain Coordinates for d1jssb_:

Click to download the PDB-style file with coordinates for d1jssb_.
(The format of our PDB-style files is described here.)

Timeline for d1jssb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jssa_