Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.2: STAR domain [55966] (4 proteins) automatically mapped to Pfam PF01852 |
Protein Cholesterol-regulated Start protein 4 (Stard4). [75545] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [75546] (1 PDB entry) |
Domain d1jssb_: 1jss B: [71845] |
PDB Entry: 1jss (more details), 2.2 Å
SCOPe Domain Sequences for d1jssb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jssb_ d.129.3.2 (B:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} asistklqntliqyhsieedewrvakkakdvtvwrkpseefngylykaqgvmddvvnnvi dhirpgpwrldwdrlmtsldvlehfeenccvmryttagqllniisprefvdfsytvgyee gllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtdlrgmipqsavd tamastlanfysdlrkglr
Timeline for d1jssb_: