Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins) |
Protein Cucumovirus coat protein [88640] (4 species) |
Species BMV (Brome mosaic virus) [TaxId:12302] [74886] (3 PDB entries) |
Domain d1js9c_: 1js9 C: [71842] complexed with mg, p6g |
PDB Entry: 1js9 (more details), 3.4 Å
SCOPe Domain Sequences for d1js9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1js9c_ b.121.4.5 (C:) Cucumovirus coat protein {BMV (Brome mosaic virus) [TaxId: 12302]} mstsgtgkmtraqrraaarrnrwtarvqpviveplaagqgkaikaiagysiskweassda itakatnamsitlphelsseknkelkvgrvllwlgllpsvagrikacvaekqaqaeaafq valavadsskevvaamytdafrgatlgdllnlqiylyaseavpakavvvhlevehvrptf ddfftpvyr
Timeline for d1js9c_: