Lineage for d1js9c_ (1js9 C:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163238Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 163239Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 163253Family b.10.1.2: Plant virus proteins [49616] (16 proteins)
  6. 163254Protein BMV coat protein [74885] (1 species)
  7. 163255Species Brome mosaic virus [TaxId:12302] [74886] (1 PDB entry)
  8. 163258Domain d1js9c_: 1js9 C: [71842]

Details for d1js9c_

PDB Entry: 1js9 (more details), 3.4 Å

PDB Description: brome mosaic virus

SCOP Domain Sequences for d1js9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1js9c_ b.10.1.2 (C:) BMV coat protein {Brome mosaic virus}
mstsgtgkmtraqrraaarrnrwtarvqpviveplaagqgkaikaiagysiskweassda
itakatnamsitlphelsseknkelkvgrvllwlgllpsvagrikacvaekqaqaeaafq
valavadsskevvaamytdafrgatlgdllnlqiylyaseavpakavvvhlevehvrptf
ddfftpvyr

SCOP Domain Coordinates for d1js9c_:

Click to download the PDB-style file with coordinates for d1js9c_.
(The format of our PDB-style files is described here.)

Timeline for d1js9c_: