PDB entry 1js9

View 1js9 on RCSB PDB site
Description: Brome Mosaic Virus
Class: virus
Keywords: PLANT VIRUS, CAPSID PROTEIN, COAT PROTEIN, BROMOVIRUSES, BMV, Icosahedral virus, Virus
Deposited on 2001-08-16, released 2002-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1js9a_
  • Chain 'B':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1js9b_
  • Chain 'C':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1js9c_
  • Heterogens: MG, P6G

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1js9A (A:)
    mstsgtgkmtraqrraaarrnrwtarvqpviveplaagqgkaikaiagysiskweassda
    itakatnamsitlphelsseknkelkvgrvllwlgllpsvagrikacvaekqaqaeaafq
    valavadsskevvaamytdafrgatlgdllnlqiylyaseavpakavvvhlevehvrptf
    ddfftpvyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1js9A (A:)
    kaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlgllpsv
    agrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiylyase
    avpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1js9B (B:)
    mstsgtgkmtraqrraaarrnrwtarvqpviveplaagqgkaikaiagysiskweassda
    itakatnamsitlphelsseknkelkvgrvllwlgllpsvagrikacvaekqaqaeaafq
    valavadsskevvaamytdafrgatlgdllnlqiylyaseavpakavvvhlevehvrptf
    ddfftpvyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1js9B (B:)
    arvqpviveplaagqgkaikaiagysiskweassdaitakatnamsitlphelsseknke
    lkvgrvllwlgllpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrga
    tlgdllnlqiylyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1js9C (C:)
    mstsgtgkmtraqrraaarrnrwtarvqpviveplaagqgkaikaiagysiskweassda
    itakatnamsitlphelsseknkelkvgrvllwlgllpsvagrikacvaekqaqaeaafq
    valavadsskevvaamytdafrgatlgdllnlqiylyaseavpakavvvhlevehvrptf
    ddfftpvyr