Lineage for d1j5eq_ (1j5e Q:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2790014Protein Ribosomal protein S17 [50304] (3 species)
  7. 2790044Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 2790045Domain d1j5eq_: 1j5e Q: [71560]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
    complexed with unx, zn
    has additional insertions and/or extensions that are not grouped together

Details for d1j5eq_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d1j5eq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5eq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOPe Domain Coordinates for d1j5eq_:

Click to download the PDB-style file with coordinates for d1j5eq_.
(The format of our PDB-style files is described here.)

Timeline for d1j5eq_: