PDB entry 1j5e

View 1j5e on RCSB PDB site
Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
Class: ribosome
Keywords: 30s ribosomal subunit, ribosome
Deposited on 2002-04-08, released 2002-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.208
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16S ribosomal RNA
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'B':
    Compound: 30S ribosomal protein S2
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB CAC3506
    Domains in SCOPe 2.07: d1j5eb_
  • Chain 'C':
    Compound: 30S ribosomal protein S3
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB CAC35062
    Domains in SCOPe 2.07: d1j5ec1, d1j5ec2
  • Chain 'D':
    Compound: 30S ribosomal protein S4
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5ed_
  • Chain 'E':
    Compound: 30S ribosomal protein S5
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5ee1, d1j5ee2
  • Chain 'F':
    Compound: 30S ribosomal protein S6
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5ef_
  • Chain 'G':
    Compound: 30S ribosomal protein S7
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5eg_
  • Chain 'H':
    Compound: 30S ribosomal protein S8
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5eh_
  • Chain 'I':
    Compound: 30S ribosomal protein S9
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB CAC35063 (Start-127)
    Domains in SCOPe 2.07: d1j5ei_
  • Chain 'J':
    Compound: 30S ribosomal protein S10
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5ej_
  • Chain 'K':
    Compound: 30S ribosomal protein S11
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB BAA75547 (Start-128)
    Domains in SCOPe 2.07: d1j5ek_
  • Chain 'L':
    Compound: 30S ribosomal protein S12
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5el_
  • Chain 'M':
    Compound: 30S ribosomal protein S13
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB BAA75546 (Start-125)
    Domains in SCOPe 2.07: d1j5em_
  • Chain 'N':
    Compound: 30S ribosomal protein S14
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5en_
  • Chain 'O':
    Compound: 30S ribosomal protein S15
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5eo_
  • Chain 'P':
    Compound: 30S ribosomal protein S16
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5ep_
  • Chain 'Q':
    Compound: 30S ribosomal protein S17
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5eq_
  • Chain 'R':
    Compound: 30S ribosomal protein S18
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • EMBL AAF27297 (Start-87)
    Domains in SCOPe 2.07: d1j5er_
  • Chain 'S':
    Compound: 30S ribosomal protein S19
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5es_
  • Chain 'T':
    Compound: 30S ribosomal protein S20
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAC15067 (Start-105)
      • conflict (40)
    Domains in SCOPe 2.07: d1j5et_
  • Chain 'V':
    Compound: 30S ribosomal protein Thx
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5ev_
  • Heterogens: ZN, UNX

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j5eB (B:)
    mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfied
    lamrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelea
    lfaspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearkl
    fipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    eaeatetpegesevea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eB (B:)
    vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
    tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
    ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
    ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j5eC (C:)
    mgnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdiera
    adnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrv
    aeqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlra
    nidygfalarttygvlgvkayiflgeviggqkpkarpelpkaeerprrrrpavrvkkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eC (C:)
    gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
    dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
    eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
    idygfalarttygvlgvkayiflgev
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j5eD (D:)
    gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
    qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
    rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
    kgkflrlpdredlalpvneqlviefysr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1j5eE (E:)
    petdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyy
    arrnmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltk
    elgsrnpiniayatmealrqlrtkadverlrkgeahaqaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eE (E:)
    dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
    nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
    srnpiniayatmealrqlrtkadverlrkg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j5eF (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j5eG (G:)
    arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
    fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
    helmdaaegkggavkkkedvermaeanrayahyrw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j5eH (H:)
    mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
    vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
    drearklgvggelicevw
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1j5eI (I:)
    meqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfd
    ayitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkar
    rapqyskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eI (I:)
    eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
    yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
    apqyskr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1j5eJ (J:)
    pkiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsre
    hfelrthnrlvdiinpnrktieqlmtldlptgveieiktvgggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eJ (J:)
    kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
    felrthnrlvdiinpnrktieqlmtldlptgveieikt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1j5eK (K:)
    makkpskkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpya
    aqlaaldaakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcr
    pkkkfrkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eK (K:)
    krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
    kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1j5eL (L:)
    mvalptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrl
    tsgyevtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrsky
    gtkkpkeaaktaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eL (L:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1j5eM (M:)
    mariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyv
    entwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagk
    kkaprk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eM (M:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
    kaprk
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j5eN (N:)
    arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j5eO (O:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1j5eP (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqearega
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eP (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqe
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j5eQ (Q:)
    pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
    srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1j5eR (R:)
    mstknakpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsg
    keqrilaktikrarilgllpfteklvrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eR (R:)
    psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
    lgllpfteklvrk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1j5eS (S:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyrghgkeakatkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eS (S:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1j5eT (T:)
    maqkkpkrnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkae
    slidkaakgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eT (T:)
    rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
    kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1j5eV (V:)
    gkgdrrtrrgkiwrgtygkyrprkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5eV (V:)
    gkgdrrtrrgkiwrgtygkyrprk