Lineage for d1j5eq_ (1j5e Q:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (15 proteins) 
Protein Ribosomal protein S17 [50304] (2 species) Species Thermus thermophilus [TaxId:274] [50305] (10 PDB entries) 
Domain d1j5eq_: 1j5e Q: [71560]
Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
Details for d1j5eq_
PDB Entry: 1j5e (more details), 3.05 Å
PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
SCOP Domain Sequences for d1j5eq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5eq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
SCOP Domain Coordinates for d1j5eq_:
Click to download the PDB-style file with coordinates for d1j5eq_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j5eq_:
- d1j5eq_ is new in SCOP 1.61
- d1j5eq_ appears in SCOP 1.63
- d1j5eq_ appears in the current release, SCOPe 2.08
View in 3D
