Lineage for d1j5eh_ (1j5e H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978267Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2978268Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2978269Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2978270Protein Ribosomal protein S8 [56049] (4 species)
  7. 2978288Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 2978291Domain d1j5eh_: 1j5e H: [71551]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
    complexed with unx, zn

Details for d1j5eh_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1j5eh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5eh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d1j5eh_:

Click to download the PDB-style file with coordinates for d1j5eh_.
(The format of our PDB-style files is described here.)

Timeline for d1j5eh_: