Lineage for d1h0oa_ (1h0o A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 911704Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 911853Protein Ribonucleotide reductase R2 [47257] (9 species)
  7. 911935Species Mouse (Mus musculus) [TaxId:10090] [47260] (5 PDB entries)
    Uniprot P11157
  8. 911938Domain d1h0oa_: 1h0o A: [70845]
    complexed with co

Details for d1h0oa_

PDB Entry: 1h0o (more details), 2.2 Å

PDB Description: cobalt substitution of mouse r2 ribonucleotide reductase to model the reactive diferrous state
PDB Compounds: (A:) ribonucleoside-diphosphate reductase

SCOPe Domain Sequences for d1h0oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0oa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]}
npsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpde
rhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidty
ikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasi
fwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqef
ltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfme

SCOPe Domain Coordinates for d1h0oa_:

Click to download the PDB-style file with coordinates for d1h0oa_.
(The format of our PDB-style files is described here.)

Timeline for d1h0oa_: