SCOP 1.75: Domain d1h0oa_: 1h0o A:

Lineage for d1h0oa_ (1h0o A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47260] (5 PDB entries)
   Uniprot P11157

8. Domain d1h0oa_: 1h0o A: [70845]
   complexed with co

Details for d1h0oa_

PDB Entry: 1h0o, 2.2 Å

PDB Description: cobalt substitution of mouse r2 ribonucleotide reductase to model the reactive diferrous state

PDB Compounds: (A:) ribonucleoside-diphosphate reductase

SCOP Domain Sequences for d1h0oa_:

Sequence; same for both SEQRES and ATOM records:

>d1h0oa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]}
npsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpde
rhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidty
ikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasi
fwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqef
ltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfme

Timeline for d1h0oa_:

• d1h0oa_ first appeared in SCOP 1.61
  
• d1h0oa_ appears in SCOP 1.73
  
• d1h0oa_ appears in SCOPe 2.01
  
• d1h0oa_ appears in the current release, SCOPe 2.08