Lineage for d1h0oa_ (1h0o A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.25: Ferritin-like [47239] (1 superfamily) Superfamily a.25.1: Ferritin-like [47240] (2 families) 
Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins) 
Protein Ribonucleotide reductase R2 [47257] (5 species) 
Species Mouse (Mus musculus) [TaxId:10090] [47260] (3 PDB entries) 
Domain d1h0oa_: 1h0o A: [70845]
Details for d1h0oa_
PDB Entry: 1h0o (more details), 2.2 Å
PDB Description: cobalt substitution of mouse r2 ribonucleotide reductase to model the reactive diferrous state
SCOP Domain Sequences for d1h0oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0oa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus)}
npsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpde
rhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidty
ikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasi
fwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqef
ltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfme
SCOP Domain Coordinates for d1h0oa_:
Click to download the PDB-style file with coordinates for d1h0oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h0oa_:
- d1h0oa_ is new in SCOP 1.61
- d1h0oa_ appears in SCOP 1.63
- d1h0oa_ appears in the current release, SCOPe 2.08
View in 3D