Lineage for d1h0ga3 (1h0g A:292-379)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255712Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 255830Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 255831Family d.26.3.1: Chitinase insertion domain [54557] (8 proteins)
  6. 255857Protein Chitinase B [54560] (1 species)
  7. 255858Species Serratia marcescens [TaxId:615] [54561] (9 PDB entries)
  8. 255871Domain d1h0ga3: 1h0g A:292-379 [70834]
    Other proteins in same PDB: d1h0ga1, d1h0ga2, d1h0gb1, d1h0gb2

Details for d1h0ga3

PDB Entry: 1h0g (more details), 2 Å

PDB Description: complex of a chitinase with the natural product cyclopentapeptide argadin from clonostachys

SCOP Domain Sequences for d1h0ga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0ga3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOP Domain Coordinates for d1h0ga3:

Click to download the PDB-style file with coordinates for d1h0ga3.
(The format of our PDB-style files is described here.)

Timeline for d1h0ga3: