SCOP 1.61: Domain d1h0ga3: 1h0g A:292-379

Lineage for d1h0ga3 (1h0g A:292-379)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (6 proteins)

6. Protein Chitinase B [54560] (1 species)

7. Species Serratia marcescens [TaxId:615] [54561] (8 PDB entries)

8. Domain d1h0ga3: 1h0g A:292-379 [70834]
   Other proteins in same PDB: d1h0ga1, d1h0ga2, d1h0gb1, d1h0gb2

Details for d1h0ga3

PDB Entry: 1h0g, 2 Å

PDB Description: complex of a chitinase with the natural product cyclopentapeptide argadin from clonostachys

SCOP Domain Sequences for d1h0ga3:

Sequence; same for both SEQRES and ATOM records:

>d1h0ga3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

Timeline for d1h0ga3:

• d1h0ga3 is new in SCOP 1.61
  
• d1h0ga3 appears in SCOP 1.63
  
• d1h0ga3 appears in the current release, SCOPe 2.08