Lineage for d1h0gb2 (1h0g B:3-291,B:380-446)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236839Family c.1.8.5: Type II chitinase [51534] (11 proteins)
    glycosylase family 18
  6. 236865Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 236866Species Serratia marcescens [TaxId:615] [51547] (9 PDB entries)
  8. 236880Domain d1h0gb2: 1h0g B:3-291,B:380-446 [70836]
    Other proteins in same PDB: d1h0ga1, d1h0ga3, d1h0gb1, d1h0gb3
    complexed with ace, gol, un1, un2

Details for d1h0gb2

PDB Entry: 1h0g (more details), 2 Å

PDB Description: complex of a chitinase with the natural product cyclopentapeptide argadin from clonostachys

SCOP Domain Sequences for d1h0gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0gb2 c.1.8.5 (B:3-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrtk
faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOP Domain Coordinates for d1h0gb2:

Click to download the PDB-style file with coordinates for d1h0gb2.
(The format of our PDB-style files is described here.)

Timeline for d1h0gb2: