SCOPe 2.08: Domain d1gytd1: 1gyt D:1-178

Lineage for d1gytd1 (1gyt D:1-178)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.1: Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52950] (1 protein)

6. Protein Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52951] (2 species)

7. Species Escherichia coli, PepA [TaxId:562] [75241] (1 PDB entry)
   involved in Xer site-specific recombination; probable DNA-binding domain

8. Domain d1gytd1: 1gyt D:1-178 [70771]
   Other proteins in same PDB: d1gyta2, d1gytb2, d1gytc2, d1gytd2, d1gyte2, d1gytf2, d1gytg2, d1gyth2, d1gyti2, d1gytj2, d1gytk2, d1gytl2
   complexed with cl, co3, zn

Details for d1gytd1

PDB Entry: 1gyt, 2.5 Å

PDB Description: e. coli aminopeptidase a (pepa)

PDB Compounds: (D:) cytosol aminopeptidase

SCOPe Domain Sequences for d1gytd1:

Sequence; same for both SEQRES and ATOM records:

>d1gytd1 c.50.1.1 (D:1-178) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Escherichia coli, PepA [TaxId: 562]}
mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhgl

Timeline for d1gytd1:

• d1gytd1 first appeared in SCOP 1.61
  
• d1gytd1 appears in SCOPe 2.07