SCOPe 2.08: Domain d1gytc2: 1gyt C:179-503

Lineage for d1gytc2 (1gyt C:179-503)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.3: Leucine aminopeptidase, C-terminal domain [53201] (2 proteins)
   automatically mapped to Pfam PF00883

6. Protein Leucine aminopeptidase, C-terminal domain [53202] (2 species)

7. Species Escherichia coli, PepA [TaxId:562] [75249] (1 PDB entry)

8. Domain d1gytc2: 1gyt C:179-503 [70770]
   Other proteins in same PDB: d1gyta1, d1gytb1, d1gytc1, d1gytd1, d1gyte1, d1gytf1, d1gytg1, d1gyth1, d1gyti1, d1gytj1, d1gytk1, d1gytl1
   complexed with cl, co3, zn

Details for d1gytc2

PDB Entry: 1gyt, 2.5 Å

PDB Description: e. coli aminopeptidase a (pepa)

PDB Compounds: (C:) cytosol aminopeptidase

SCOPe Domain Sequences for d1gytc2:

Sequence; same for both SEQRES and ATOM records:

>d1gytc2 c.56.5.3 (C:179-503) Leucine aminopeptidase, C-terminal domain {Escherichia coli, PepA [TaxId: 562]}
aiaagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsyla
vgqgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaa
avygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlv
lcdvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdraw
rlplgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgka
kgatgrpvallaqfllnragfngee

Timeline for d1gytc2:

• d1gytc2 first appeared in SCOP 1.61
  
• d1gytc2 appears in SCOPe 2.07