Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.3: Leucine aminopeptidase, C-terminal domain [53201] (2 proteins) automatically mapped to Pfam PF00883 |
Protein Leucine aminopeptidase, C-terminal domain [53202] (2 species) |
Species Escherichia coli, PepA [TaxId:562] [75249] (1 PDB entry) |
Domain d1gytc2: 1gyt C:179-503 [70770] Other proteins in same PDB: d1gyta1, d1gytb1, d1gytc1, d1gytd1, d1gyte1, d1gytf1, d1gytg1, d1gyth1, d1gyti1, d1gytj1, d1gytk1, d1gytl1 complexed with cl, co3, zn |
PDB Entry: 1gyt (more details), 2.5 Å
SCOPe Domain Sequences for d1gytc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gytc2 c.56.5.3 (C:179-503) Leucine aminopeptidase, C-terminal domain {Escherichia coli, PepA [TaxId: 562]} aiaagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsyla vgqgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaa avygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlv lcdvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdraw rlplgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgka kgatgrpvallaqfllnragfngee
Timeline for d1gytc2: