Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) |
Family c.50.1.1: Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52950] (1 protein) |
Protein Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52951] (2 species) |
Species Escherichia coli, PepA [TaxId:562] [75241] (1 PDB entry) involved in Xer site-specific recombination; probable DNA-binding domain |
Domain d1gyte1: 1gyt E:1-178 [70773] Other proteins in same PDB: d1gyta2, d1gytb2, d1gytc2, d1gytd2, d1gyte2, d1gytf2, d1gytg2, d1gyth2, d1gyti2, d1gytj2, d1gytk2, d1gytl2 complexed with cl, co3, zn |
PDB Entry: 1gyt (more details), 2.5 Å
SCOPe Domain Sequences for d1gyte1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gyte1 c.50.1.1 (E:1-178) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Escherichia coli, PepA [TaxId: 562]} mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhgl
Timeline for d1gyte1: