PDB entry 1gyt

View 1gyt on RCSB PDB site
Description: E. coli Aminopeptidase A (PepA)
Class: hydrolase
Keywords: hydrolase, peptidase, DNA recombination, aminopeptidase
Deposited on 2002-04-29, released 2002-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytosol aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gyta1, d1gyta2
  • Chain 'B':
    Compound: cytosol aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gytb1, d1gytb2
  • Chain 'C':
    Compound: cytosol aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gytc1, d1gytc2
  • Chain 'D':
    Compound: cytosol aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gytd1, d1gytd2
  • Chain 'E':
    Compound: cytosol aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gyte1, d1gyte2
  • Chain 'F':
    Compound: cytosol aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gytf1, d1gytf2
  • Chain 'G':
    Compound: cytosol aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gytg1, d1gytg2
  • Chain 'H':
    Compound: cytosol aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gyth1, d1gyth2
  • Chain 'I':
    Compound: cytosol aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gyti1, d1gyti2
  • Chain 'J':
    Compound: cytosol aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gytj1, d1gytj2
  • Chain 'K':
    Compound: cytosol aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gytk1, d1gytk2
  • Chain 'L':
    Compound: cytosol aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gytl1, d1gytl2
  • Heterogens: ZN, CO3, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gytA (A:)
    mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
    llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
    nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhglai
    aagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsylavg
    qgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaaav
    ygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlvlc
    dvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdrawrl
    plgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgkakg
    atgrpvallaqfllnragfngee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gytB (B:)
    mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
    llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
    nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhglai
    aagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsylavg
    qgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaaav
    ygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlvlc
    dvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdrawrl
    plgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgkakg
    atgrpvallaqfllnragfngee
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gytC (C:)
    mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
    llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
    nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhglai
    aagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsylavg
    qgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaaav
    ygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlvlc
    dvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdrawrl
    plgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgkakg
    atgrpvallaqfllnragfngee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gytD (D:)
    mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
    llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
    nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhglai
    aagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsylavg
    qgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaaav
    ygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlvlc
    dvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdrawrl
    plgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgkakg
    atgrpvallaqfllnragfngee
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gytE (E:)
    mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
    llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
    nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhglai
    aagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsylavg
    qgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaaav
    ygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlvlc
    dvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdrawrl
    plgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgkakg
    atgrpvallaqfllnragfngee
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gytF (F:)
    mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
    llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
    nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhglai
    aagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsylavg
    qgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaaav
    ygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlvlc
    dvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdrawrl
    plgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgkakg
    atgrpvallaqfllnragfngee
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gytG (G:)
    mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
    llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
    nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhglai
    aagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsylavg
    qgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaaav
    ygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlvlc
    dvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdrawrl
    plgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgkakg
    atgrpvallaqfllnragfngee
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gytH (H:)
    mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
    llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
    nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhglai
    aagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsylavg
    qgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaaav
    ygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlvlc
    dvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdrawrl
    plgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgkakg
    atgrpvallaqfllnragfngee
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gytI (I:)
    mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
    llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
    nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhglai
    aagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsylavg
    qgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaaav
    ygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlvlc
    dvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdrawrl
    plgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgkakg
    atgrpvallaqfllnragfngee
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gytJ (J:)
    mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
    llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
    nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhglai
    aagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsylavg
    qgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaaav
    ygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlvlc
    dvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdrawrl
    plgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgkakg
    atgrpvallaqfllnragfngee
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gytK (K:)
    mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
    llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
    nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhglai
    aagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsylavg
    qgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaaav
    ygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlvlc
    dvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdrawrl
    plgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgkakg
    atgrpvallaqfllnragfngee
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gytL (L:)
    mefsvksgspekqrsacivvgvfeprrlspiaeqldkisdgyisallrrgelegkpgqtl
    llhhvpnvlserilligcgkerelderqykqviqktintlndtgsmeavcfltelhvkgr
    nnywkvrqavetaketlysfdqlktnkseprrplrkmvfnvptrreltsgeraiqhglai
    aagikaakdlgnmppnicnaaylasqarqladsysknvitrvigeqqmkelgmhsylavg
    qgsqneslmsvieykgnasedarpivlvgkgltfdsggisikpsegmdemkydmcgaaav
    ygvmrmvaelqlpinvigvlagcenmpggrayrpgdvlttmsgqtvevlntdaegrlvlc
    dvltyverfepeavidvatltgacvialghhitglmanhnplaheliaaseqsgdrawrl
    plgdeyqeqlesnfadmaniggrpggaitagcflsrftrkynwahldiagtawrsgkakg
    atgrpvallaqfllnragfngee