Lineage for d1eakb1 (1eak B:32-107)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697917Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 2697918Superfamily a.20.1: PGBD-like [47090] (3 families) (S)
  5. 2697928Family a.20.1.2: MMP N-terminal domain [63427] (4 proteins)
  6. 2697933Protein Gelatinase A (MMP-2) [63428] (1 species)
  7. 2697934Species Human (Homo sapiens) [TaxId:9606] [63430] (3 PDB entries)
  8. 2697936Domain d1eakb1: 1eak B:32-107 [70098]
    Other proteins in same PDB: d1eaka2, d1eaka3, d1eaka4, d1eaka5, d1eakb2, d1eakb3, d1eakb4, d1eakb5, d1eakc2, d1eakc3, d1eakc4, d1eakc5, d1eakd2, d1eakd3, d1eakd4, d1eakd5
    complexed with ca, so4, zn; mutant

Details for d1eakb1

PDB Entry: 1eak (more details), 2.66 Å

PDB Description: catalytic domain of prommp-2 e404q mutant
PDB Compounds: (B:) 72 kda type IV collagenase

SCOPe Domain Sequences for d1eakb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eakb1 a.20.1.2 (B:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]}
spiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdldq
ntietmrkprcgnpdv

SCOPe Domain Coordinates for d1eakb1:

Click to download the PDB-style file with coordinates for d1eakb1.
(The format of our PDB-style files is described here.)

Timeline for d1eakb1: