![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
![]() | Protein Gelatinase A [55534] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55535] (4 PDB entries) |
![]() | Domain d1eakc2: 1eak C:108-216,C:394-449 [70104] Other proteins in same PDB: d1eaka1, d1eaka3, d1eaka4, d1eaka5, d1eakb1, d1eakb3, d1eakb4, d1eakb5, d1eakc1, d1eakc3, d1eakc4, d1eakc5, d1eakd1, d1eakd3, d1eakd4, d1eakd5 complexed with ca, so4, zn; mutant |
PDB Entry: 1eak (more details), 2.66 Å
SCOPe Domain Sequences for d1eakc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eakc2 d.92.1.11 (C:108-216,C:394-449) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} anynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgea diminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtlgXgyslflvaah qfghamglehsqdpgalmapiytytknfrlsqddikgiqelygasp
Timeline for d1eakc2:
![]() Domains from same chain: (mouse over for more information) d1eakc1, d1eakc3, d1eakc4, d1eakc5 |