PDB entry 1eak

View 1eak on RCSB PDB site
Description: Catalytic domain of proMMP-2 E404Q mutant
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase a, hydrolase- hydrolase inhibitor complex
Deposited on 2001-07-12, released 2002-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 72 kda type IV collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08253 (0-420)
      • engineered mutation (372)
    Domains in SCOPe 2.07: d1eaka1, d1eaka2, d1eaka3, d1eaka4, d1eaka5
  • Chain 'B':
    Compound: 72 kda type IV collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08253 (0-End)
      • engineered mutation (372)
    Domains in SCOPe 2.07: d1eakb1, d1eakb2, d1eakb3, d1eakb4, d1eakb5
  • Chain 'C':
    Compound: 72 kda type IV collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08253 (0-End)
      • engineered mutation (372)
    Domains in SCOPe 2.07: d1eakc1, d1eakc2, d1eakc3, d1eakc4, d1eakc5
  • Chain 'D':
    Compound: 72 kda type IV collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08253 (0-End)
      • engineered mutation (372)
    Domains in SCOPe 2.07: d1eakd1, d1eakd2, d1eakd3, d1eakd4, d1eakd5
  • Chain 'P':
    Compound: Inhibitor peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EAK (0-7)
  • Chain 'R':
    Compound: Inhibitor peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EAK (0-7)
  • Heterogens: SO4, ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eakA (A:)
    spiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdldq
    ntietmrkprcgnpdvanynffprkpkwdknqityriigytpdldpetvddafarafqvw
    sdvtplrfsrihdgeadiminfgrwehgdgypfdgkdgllahafapgtgvggdshfddde
    lwtlgegqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgky
    gfcphealftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygf
    cpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcp
    dqgyslflvaahqfghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspdi
    d
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eakB (B:)
    spiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdldq
    ntietmrkprcgnpdvanynffprkpkwdknqityriigytpdldpetvddafarafqvw
    sdvtplrfsrihdgeadiminfgrwehgdgypfdgkdgllahafapgtgvggdshfddde
    lwtlgegqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgky
    gfcphealftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygf
    cpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcp
    dqgyslflvaahqfghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspdi
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eakB (B:)
    spiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdldq
    ntietmrkprcgnpdvanynffprkpkwdknqityriigytpdldpetvddafarafqvw
    sdvtplrfsrihdgeadiminfgrwehgdgypfdgkdgllahafapgtgvggdshfddde
    lwtlgegqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgky
    gfcphealftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygf
    cpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcp
    dqgyslflvaahqfghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eakC (C:)
    spiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdldq
    ntietmrkprcgnpdvanynffprkpkwdknqityriigytpdldpetvddafarafqvw
    sdvtplrfsrihdgeadiminfgrwehgdgypfdgkdgllahafapgtgvggdshfddde
    lwtlgegqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgky
    gfcphealftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygf
    cpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcp
    dqgyslflvaahqfghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspdi
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eakC (C:)
    spiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdldq
    ntietmrkprcgnpdvanynffprkpkwdknqityriigytpdldpetvddafarafqvw
    sdvtplrfsrihdgeadiminfgrwehgdgypfdgkdgllahafapgtgvggdshfddde
    lwtlgegqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgky
    gfcphealftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygf
    cpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcp
    dqgyslflvaahqfghamglehsqdpgalmapiytytknfrlsqddikgiqelygasp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eakD (D:)
    spiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdldq
    ntietmrkprcgnpdvanynffprkpkwdknqityriigytpdldpetvddafarafqvw
    sdvtplrfsrihdgeadiminfgrwehgdgypfdgkdgllahafapgtgvggdshfddde
    lwtlgegqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgky
    gfcphealftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygf
    cpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcp
    dqgyslflvaahqfghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspdi
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eakD (D:)
    spiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdldq
    ntietmrkprcgnpdvanynffprkpkwdknqityriigytpdldpetvddafarafqvw
    sdvtplrfsrihdgeadiminfgrwehgdgypfdgkdgllahafapgtgvggdshfddde
    lwtlgegqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgky
    gfcphealftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygf
    cpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcp
    dqgyslflvaahqfghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspd
    

  • Chain 'P':
    No sequence available.

  • Chain 'R':
    No sequence available.