![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.2: Fibronectin type II module [57459] (4 proteins) shorter two-disulfide version of a kringle module |
![]() | Protein Gelatinase A (MMP-2) type II modules [57464] (1 species) duplication: tandem repeat of three modules inserted in the catalytic domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries) |
![]() | Domain d1eakc4: 1eak C:278-335 [70106] Other proteins in same PDB: d1eaka1, d1eaka2, d1eakb1, d1eakb2, d1eakc1, d1eakc2, d1eakd1, d1eakd2 complexed with ca, so4, zn; mutant |
PDB Entry: 1eak (more details), 2.66 Å
SCOPe Domain Sequences for d1eakc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eakc4 g.14.1.2 (C:278-335) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens) [TaxId: 9606]} alftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpet
Timeline for d1eakc4:
![]() Domains from same chain: (mouse over for more information) d1eakc1, d1eakc2, d1eakc3, d1eakc5 |