![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Maltogenic amylase, N-terminal domain N [49221] (4 species) precedes the catalytic (beta/alpha)8-barrel domain |
![]() | Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [74842] (1 PDB entry) |
![]() | Domain d1ea9d1: 1ea9 D:1-121 [70090] Other proteins in same PDB: d1ea9c2, d1ea9c3, d1ea9d2, d1ea9d3 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ea9 (more details), 3.2 Å
SCOPe Domain Sequences for d1ea9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ea9d1 b.1.18.2 (D:1-121) Maltogenic amylase, N-terminal domain N {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} mfleavyhrprknfsyayngttvhlrirtkkddmtavyalagdkymwdhtmeyvpmtkla tdelfdywecevtppyrrvkygfllqqghekrwmteydflteppanpdrlfeypfinpvd v
Timeline for d1ea9d1: