PDB entry 1ea9

View 1ea9 on RCSB PDB site
Description: cyclomaltodextrinase
Class: hydrolase
Keywords: hydrolase, glycosidase
Deposited on 2001-07-12, released 2002-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.214
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: cyclomaltodextrinase
    Species: Bacillus sp. [TaxId:1409]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59226 (0-540)
      • conflict (13)
      • conflict (104)
    • PDB 1EA9 (541-582)
    Domains in SCOPe 2.07: d1ea9c1, d1ea9c2, d1ea9c3
  • Chain 'D':
    Compound: cyclomaltodextrinase
    Species: Bacillus sp. [TaxId:1409]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59226 (0-540)
      • conflict (13)
      • conflict (104)
    • PDB 1EA9 (541-582)
    Domains in SCOPe 2.07: d1ea9d1, d1ea9d2, d1ea9d3

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ea9C (C:)
    mfleavyhrprknfsyayngttvhlrirtkkddmtavyalagdkymwdhtmeyvpmtkla
    tdelfdywecevtppyrrvkygfllqqghekrwmteydflteppanpdrlfeypfinpvd
    vfqppawvkdaifyqifperfangdtrndpegtlpwgsadptpscffggdlqgvidhldh
    lsklgvnavyftplfkattnhkydtedyfqidpqfgdkdtlkklvdlchergirvlldav
    fnhsgrtfppfvdvlkngekskykdwfhirslplevvdgiptydtfafeplmpklntehp
    dvkeyllkaaeywiretgidgwrldvanevshqfwrefrrvvkqanpdayilgevwhess
    iwlegdqfdavmnypftnavldffihqiadaekfsfmlgkqlagyprqasevmfnlldsh
    dtarlltqadgdkrkmklavlfqftyfgtpciyygdevgldgghdpgcrkcmewdetkhd
    kdlfafyqtvirlrqahaalrtgtfkfltaeknsrqiaylreddqdtilvvmnndkaght
    ltlpvrhaqwthlwqddvltaahgqltvklpaygfavlkassd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ea9D (D:)
    mfleavyhrprknfsyayngttvhlrirtkkddmtavyalagdkymwdhtmeyvpmtkla
    tdelfdywecevtppyrrvkygfllqqghekrwmteydflteppanpdrlfeypfinpvd
    vfqppawvkdaifyqifperfangdtrndpegtlpwgsadptpscffggdlqgvidhldh
    lsklgvnavyftplfkattnhkydtedyfqidpqfgdkdtlkklvdlchergirvlldav
    fnhsgrtfppfvdvlkngekskykdwfhirslplevvdgiptydtfafeplmpklntehp
    dvkeyllkaaeywiretgidgwrldvanevshqfwrefrrvvkqanpdayilgevwhess
    iwlegdqfdavmnypftnavldffihqiadaekfsfmlgkqlagyprqasevmfnlldsh
    dtarlltqadgdkrkmklavlfqftyfgtpciyygdevgldgghdpgcrkcmewdetkhd
    kdlfafyqtvirlrqahaalrtgtfkfltaeknsrqiaylreddqdtilvvmnndkaght
    ltlpvrhaqwthlwqddvltaahgqltvklpaygfavlkassd