Lineage for d1ea9d1 (1ea9 D:1-121)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160787Protein Maltogenic amylase, N-terminal domain [49221] (4 species)
  7. 160788Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [74842] (1 PDB entry)
  8. 160790Domain d1ea9d1: 1ea9 D:1-121 [70090]
    Other proteins in same PDB: d1ea9c2, d1ea9c3, d1ea9d2, d1ea9d3

Details for d1ea9d1

PDB Entry: 1ea9 (more details), 3.2 Å

PDB Description: cyclomaltodextrinase

SCOP Domain Sequences for d1ea9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea9d1 b.1.1.5 (D:1-121) Maltogenic amylase, N-terminal domain {Bacillus sp., cyclomaltodextrinase}
mfleavyhrprknfsyayngttvhlrirtkkddmtavyalagdkymwdhtmeyvpmtkla
tdelfdywecevtppyrrvkygfllqqghekrwmteydflteppanpdrlfeypfinpvd
v

SCOP Domain Coordinates for d1ea9d1:

Click to download the PDB-style file with coordinates for d1ea9d1.
(The format of our PDB-style files is described here.)

Timeline for d1ea9d1: