SCOPe 2.06: Domain d1k83i1: 1k83 I:1-49

Lineage for d1k83i1 (1k83 I:1-49)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (5 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
   Uniprot P27999; part of multichain biological unit

8. Domain d1k83i1: 1k83 I:1-49 [68283]
   Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83j_, d1k83k_, d1k83l_
   protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d1k83i1

PDB Entry: 1k83, 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

PDB Compounds: (I:) DNA-directed RNA polymerase II 14.2kd polypeptide

SCOPe Domain Sequences for d1k83i1:

Sequence; same for both SEQRES and ATOM records:

>d1k83i1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

Timeline for d1k83i1:

• d1k83i1 first appeared in SCOP 1.59
  
• d1k83i1 appears in SCOPe 2.05
  
• d1k83i1 appears in SCOPe 2.07
  
• d1k83i1 appears in the current release, SCOPe 2.08