Lineage for d1k83b_ (1k83 B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249905Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2249906Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2249907Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 2249908Protein RBP2 [64491] (2 species)
  7. 2249909Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (27 PDB entries)
    Uniprot P08518; part of multichain biological unit
  8. 2249912Domain d1k83b_: 1k83 B: [68276]
    Other proteins in same PDB: d1k83a_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_
    protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d1k83b_

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin
PDB Compounds: (B:) DNA-directed RNA polymerase II 140kd polypeptide

SCOPe Domain Sequences for d1k83b_:

Sequence, based on SEQRES records: (download)

>d1k83b_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fedesapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqh
ttesdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrty
eaidvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpf
dmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvk
lygregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpc
vedgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkaff
lgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtve
eahdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrr
tntpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitf
lsewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmir
direkelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedve
eytwssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhatt
fthceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanily
ypqkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffr
symdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttp
ispdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqig
dkfasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaal
sgnegdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrh
mvddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasda
frvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprly
tdrsrdf

Sequence, based on observed residues (ATOM records): (download)

>d1k83b_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fedesapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlieisfgki
yvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtykvfigrlpimlrskncyl
seatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeir
salekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehi
cydvndwqmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkefl
phitqlegfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlf
kkltkdifrlainaktitsglkyalatgnwgvsqvlnrytysstlshlrrtntpiakprq
lhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgmepledyvphq
spdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirekelkiftdagrv
yrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglveyidaeeeesil
iamqpedlepdvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqsprntyqs
amgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagqnaivaiacys
gynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpqrtntlrmkhgtyd
kldddgliapgvrvsgedviigkttpskrdastplrstengivdqvlvttnqdglkfvkv
rvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahl
iecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqif
fgptyyqrlrhmvddkiharargpglrfgemerdcmiahgaasflkerlmeasdafrvhi
cgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytdrsr
df

SCOPe Domain Coordinates for d1k83b_:

Click to download the PDB-style file with coordinates for d1k83b_.
(The format of our PDB-style files is described here.)

Timeline for d1k83b_: