Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) |
Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins) |
Protein RBP9 subunit of RNA polymerase II [57787] (3 species) contains two differently decorated domains of this fold |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) Uniprot P27999; part of multichain biological unit |
Domain d1k83i1: 1k83 I:1-49 [68283] Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83j_, d1k83k_, d1k83l_ protein/DNA complex; protein/RNA complex; complexed with mn, zn |
PDB Entry: 1k83 (more details), 2.8 Å
SCOPe Domain Sequences for d1k83i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k83i1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli
Timeline for d1k83i1: