Lineage for d1k6oa_ (1k6o A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 351844Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 351873Protein Serum response factor accessory protein 1a, SAP-1 [46869] (1 species)
  7. 351874Species Human (Homo sapiens) [TaxId:9606] [46870] (4 PDB entries)
  8. 351877Domain d1k6oa_: 1k6o A: [68226]
    Other proteins in same PDB: d1k6ob_, d1k6oc_

Details for d1k6oa_

PDB Entry: 1k6o (more details), 3.19 Å

PDB Description: crystal structure of a ternary sap-1/srf/c-fos sre dna complex

SCOP Domain Sequences for d1k6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k6oa_ a.4.5.21 (A:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens)}
saitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydklsra
lryyyvkniikkvngqkfvykfvsypeil

SCOP Domain Coordinates for d1k6oa_:

Click to download the PDB-style file with coordinates for d1k6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1k6oa_: