Lineage for d1k6oa_ (1k6o A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306061Family a.4.5.21: ets domain [46859] (9 protein domains)
  6. 2306096Protein Serum response factor accessory protein 1a, SAP-1 [46869] (1 species)
  7. 2306097Species Human (Homo sapiens) [TaxId:9606] [46870] (4 PDB entries)
  8. 2306100Domain d1k6oa_: 1k6o A: [68226]
    Other proteins in same PDB: d1k6ob_, d1k6oc_
    protein/DNA complex

Details for d1k6oa_

PDB Entry: 1k6o (more details), 3.19 Å

PDB Description: crystal structure of a ternary sap-1/srf/c-fos sre dna complex
PDB Compounds: (A:) ets-domain protein elk-4

SCOPe Domain Sequences for d1k6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k6oa_ a.4.5.21 (A:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]}
saitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydklsra
lryyyvkniikkvngqkfvykfvsypeil

SCOPe Domain Coordinates for d1k6oa_:

Click to download the PDB-style file with coordinates for d1k6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1k6oa_: