SCOP 1.67: Domain d1k6ob_: 1k6o B:

Lineage for d1k6ob_ (1k6o B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.88: SRF-like [55454] (1 superfamily)
   alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet

4. Superfamily d.88.1: SRF-like [55455] (1 family)

5. Family d.88.1.1: SRF-like [55456] (4 proteins)

6. Protein Serum response factor (SRF) core [55457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries)

8. Domain d1k6ob_: 1k6o B: [68227]
   Other proteins in same PDB: d1k6oa_

Details for d1k6ob_

PDB Entry: 1k6o, 3.19 Å

PDB Description: crystal structure of a ternary sap-1/srf/c-fos sre dna complex

SCOP Domain Sequences for d1k6ob_:

Sequence; same for both SEQRES and ATOM records:

>d1k6ob_ d.88.1.1 (B:) Serum response factor (SRF) core {Human (Homo sapiens)}
gkktrgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvyt
fatrklqpmitsetgkaliqtclns

Timeline for d1k6ob_:

• d1k6ob_ first appeared in SCOP 1.59
  
• d1k6ob_ appears in SCOP 1.65
  
• d1k6ob_ appears in SCOP 1.69
  
• d1k6ob_ appears in the current release, SCOPe 2.08