![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Ran [52609] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52611] (90 PDB entries) |
![]() | Domain d1k5gd_: 1k5g D: [68183] Other proteins in same PDB: d1k5gb_, d1k5gc_, d1k5ge_, d1k5gf_, d1k5gh_, d1k5gi_, d1k5gk_, d1k5gl_ complexed with af3, gdp, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1k5g (more details), 3.1 Å
SCOPe Domain Sequences for d1k5gd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k5gd_ c.37.1.8 (D:) Ran {Human (Homo sapiens) [TaxId: 9606]} qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev vmdpalaaqyehdlevaqttalpded
Timeline for d1k5gd_: