Lineage for d1k5gh_ (1k5g H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803450Family b.55.1.3: Ran-binding domain [50764] (5 proteins)
  6. 2803458Protein Ran-binding protein 1, Ranbp1 [69292] (1 species)
  7. 2803459Species Human (Homo sapiens) [TaxId:9606] [69293] (2 PDB entries)
  8. 2803466Domain d1k5gh_: 1k5g H: [68187]
    Other proteins in same PDB: d1k5ga_, d1k5gc_, d1k5gd_, d1k5gf_, d1k5gg_, d1k5gi_, d1k5gj_, d1k5gl_
    complexed with af3, gdp, mg

Details for d1k5gh_

PDB Entry: 1k5g (more details), 3.1 Å

PDB Description: Crystal structure of Ran-GDP-AlFx-RanBP1-RanGAP complex
PDB Compounds: (H:) Ran-specific GTPase-activating protein

SCOPe Domain Sequences for d1k5gh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5gh_ b.55.1.3 (H:) Ran-binding protein 1, Ranbp1 {Human (Homo sapiens) [TaxId: 9606]}
nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
flnaenaqkfktkfeecrkeieerek

SCOPe Domain Coordinates for d1k5gh_:

Click to download the PDB-style file with coordinates for d1k5gh_.
(The format of our PDB-style files is described here.)

Timeline for d1k5gh_: