![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.3: Ran-binding domain [50764] (5 proteins) |
![]() | Protein Ran-binding protein 1, Ranbp1 [69292] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69293] (2 PDB entries) |
![]() | Domain d1k5gh_: 1k5g H: [68187] Other proteins in same PDB: d1k5ga_, d1k5gc_, d1k5gd_, d1k5gf_, d1k5gg_, d1k5gi_, d1k5gj_, d1k5gl_ complexed with af3, gdp, mg |
PDB Entry: 1k5g (more details), 3.1 Å
SCOPe Domain Sequences for d1k5gh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k5gh_ b.55.1.3 (H:) Ran-binding protein 1, Ranbp1 {Human (Homo sapiens) [TaxId: 9606]} nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair flnaenaqkfktkfeecrkeieerek
Timeline for d1k5gh_: