![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Galactose oxidase, C-terminal domain [49209] (3 species) follows the catalytic seven-bladed beta-propeller domain |
![]() | Species Fungus (Fusarium sp.) [TaxId:29916] [69164] (2 PDB entries) sequence identical to that of Dactylium dendroides |
![]() | Domain d1k3ia1: 1k3i A:538-639 [68113] Other proteins in same PDB: d1k3ia2, d1k3ia3 complexed with act, ca, glc |
PDB Entry: 1k3i (more details), 1.4 Å
SCOPe Domain Sequences for d1k3ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3ia1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Fungus (Fusarium sp.) [TaxId: 29916]} gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq
Timeline for d1k3ia1: