Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) |
Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins) |
Protein Galactose oxidase, central domain [50967] (3 species) N-terminal domain is a jelly-roll sandwich C-terminal domain is Immunoglobulin-like |
Species Fungus (Fusarium sp.) [TaxId:29916] [69308] (1 PDB entry) sequence identical to that of Dactylium dendroides |
Domain d1k3ia3: 1k3i A:151-537 [68115] Other proteins in same PDB: d1k3ia1, d1k3ia2 complexed with act, ca, glc |
PDB Entry: 1k3i (more details), 1.4 Å
SCOPe Domain Sequences for d1k3ia3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungus (Fusarium sp.) [TaxId: 29916]} ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng ggglcgdcttnhfdaqiftpnylynsn
Timeline for d1k3ia3: