Lineage for d1k3ia3 (1k3i A:151-537)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808720Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) (S)
  5. 2808721Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)
  6. 2808722Protein Galactose oxidase, central domain [50967] (3 species)
    N-terminal domain is a jelly-roll sandwich
    C-terminal domain is Immunoglobulin-like
  7. 2808728Species Fungus (Fusarium sp.) [TaxId:29916] [69308] (1 PDB entry)
    sequence identical to that of Dactylium dendroides
  8. 2808729Domain d1k3ia3: 1k3i A:151-537 [68115]
    Other proteins in same PDB: d1k3ia1, d1k3ia2
    complexed with act, ca, glc

Details for d1k3ia3

PDB Entry: 1k3i (more details), 1.4 Å

PDB Description: crystal structure of the precursor of galactose oxidase
PDB Compounds: (A:) Galactose Oxidase Precursor

SCOPe Domain Sequences for d1k3ia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungus (Fusarium sp.) [TaxId: 29916]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

SCOPe Domain Coordinates for d1k3ia3:

Click to download the PDB-style file with coordinates for d1k3ia3.
(The format of our PDB-style files is described here.)

Timeline for d1k3ia3: