![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.1: Galactose-binding domain [49786] (2 proteins) automatically mapped to Pfam PF00754 |
![]() | Protein Galactose oxidase, N-terminal domain [49787] (3 species) |
![]() | Species Fungus (Fusarium sp.) [TaxId:29916] [69209] (2 PDB entries) sequence identical to that of Dactylium dendroides |
![]() | Domain d1k3ia2: 1k3i A:-12-150 [68114] Other proteins in same PDB: d1k3ia1, d1k3ia3 complexed with act, ca, glc |
PDB Entry: 1k3i (more details), 1.4 Å
SCOPe Domain Sequences for d1k3ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3ia2 b.18.1.1 (A:-12-150) Galactose oxidase, N-terminal domain {Fungus (Fusarium sp.) [TaxId: 29916]} ipegslqflslrasapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangd pkpphtytidmkttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfad sttkysnfetrparyvrlvaiteangqpwtsiaeinvfqass
Timeline for d1k3ia2: