Lineage for d1k1ba_ (1k1b A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265660Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 265661Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 265662Family d.211.1.1: Ankyrin repeat [48404] (12 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 265669Protein bcl-3 [69091] (1 species)
    a member of the I-kappa-B family
  7. 265670Species Human (Homo sapiens) [TaxId:9606] [69092] (2 PDB entries)
  8. 265672Domain d1k1ba_: 1k1b A: [67993]

Details for d1k1ba_

PDB Entry: 1k1b (more details), 1.9 Å

PDB Description: Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family

SCOP Domain Sequences for d1k1ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1ba_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens)}
edgdtplhiavvqgnlpavhrlvnlfqqggreldiynnlrqtplhlavittlpsvvrllv
tagaspmaldrhgqtaahlacehrsptclralldsaapgtldlearnydgltalhvavnt
ecqetvqlllergadidavdiksgrsplihavennslsmvqlllqhganvnaqmysgssa
lhsasgrgllplvrtlvrsgadsslknchndtplmvarsrrvidilrg

SCOP Domain Coordinates for d1k1ba_:

Click to download the PDB-style file with coordinates for d1k1ba_.
(The format of our PDB-style files is described here.)

Timeline for d1k1ba_: