Lineage for d1k1ba_ (1k1b A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100538Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies)
  4. 100649Superfamily a.118.2: Ankyrin repeat [48403] (1 family) (S)
  5. 100650Family a.118.2.1: Ankyrin repeat [48404] (10 proteins)
  6. 100654Protein bcl-3 [69091] (1 species)
  7. 100655Species Human (Homo sapiens) [TaxId:9606] [69092] (2 PDB entries)
  8. 100657Domain d1k1ba_: 1k1b A: [67993]

Details for d1k1ba_

PDB Entry: 1k1b (more details), 1.9 Å

PDB Description: Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family

SCOP Domain Sequences for d1k1ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1ba_ a.118.2.1 (A:) bcl-3 {Human (Homo sapiens)}
edgdtplhiavvqgnlpavhrlvnlfqqggreldiynnlrqtplhlavittlpsvvrllv
tagaspmaldrhgqtaahlacehrsptclralldsaapgtldlearnydgltalhvavnt
ecqetvqlllergadidavdiksgrsplihavennslsmvqlllqhganvnaqmysgssa
lhsasgrgllplvrtlvrsgadsslknchndtplmvarsrrvidilrg

SCOP Domain Coordinates for d1k1ba_:

Click to download the PDB-style file with coordinates for d1k1ba_.
(The format of our PDB-style files is described here.)

Timeline for d1k1ba_: