PDB entry 1k1b

View 1k1b on RCSB PDB site
Description: Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family
Deposited on 2001-09-24, released 2001-11-21
The last revision prior to the SCOP 1.63 freeze date was dated 2001-11-21, with a file datestamp of 2001-11-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1k1ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k1bA (A:)
    edgdtplhiavvqgnlpavhrlvnlfqqggreldiynnlrqtplhlavittlpsvvrllv
    tagaspmaldrhgqtaahlacehrsptclralldsaapgtldlearnydgltalhvavnt
    ecqetvqlllergadidavdiksgrsplihavennslsmvqlllqhganvnaqmysgssa
    lhsasgrgllplvrtlvrsgadsslknchndtplmvarsrrvidilrg