SCOPe 2.08: Domain d1jumd1: 1jum D:2-72

Lineage for d1jumd1 (1jum D:2-72)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
   Uniprot P23217

8. Domain d1jumd1: 1jum D:2-72 [67308]
   Other proteins in same PDB: d1juma2, d1jumb2, d1jumd2, d1jume2
   complexed with ber, so4

Details for d1jumd1

PDB Entry: 1jum, 2.98 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to the natural drug berberine

PDB Compounds: (D:) hypothetical transcriptional regulator in qaca 5'region

SCOPe Domain Sequences for d1jumd1:

Sequence; same for both SEQRES and ATOM records:

>d1jumd1 a.4.1.9 (D:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

Timeline for d1jumd1:

• d1jumd1 first appeared in SCOP 1.59
  
• d1jumd1 appears in SCOPe 2.07