SCOPe 2.08: Domain d1jrpe1: 1jrp E:85-166

Lineage for d1jrpe1 (1jrp E:85-166)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)

6. Protein Xanthine dehydrogenase chain A, domain 2 [69040] (1 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [69041] (2 PDB entries)

8. Domain d1jrpe1: 1jrp E:85-166 [67173]
   Other proteins in same PDB: d1jrpa2, d1jrpa3, d1jrpa4, d1jrpb1, d1jrpb2, d1jrpc2, d1jrpc3, d1jrpc4, d1jrpd1, d1jrpd2, d1jrpe2, d1jrpe3, d1jrpe4, d1jrpf1, d1jrpf2, d1jrpg2, d1jrpg3, d1jrpg4, d1jrph1, d1jrph2
   complexed with 141, ca, fad, fes, mos, mte

Details for d1jrpe1

PDB Entry: 1jrp, 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus

PDB Compounds: (E:) xanthine dehydrogenase, chain A

SCOPe Domain Sequences for d1jrpe1:

Sequence; same for both SEQRES and ATOM records:

>d1jrpe1 a.56.1.1 (E:85-166) Xanthine dehydrogenase chain A, domain 2 {Rhodobacter capsulatus [TaxId: 1061]}
dgrlhpvqqamidhhgsqcgfctpgfivsmaaahdrdrkdyddllagnlcrctgyapilr
aaeaaageppadwlqadaaftl

Timeline for d1jrpe1:

• d1jrpe1 first appeared in SCOP 1.59
  
• d1jrpe1 appears in SCOPe 2.07